PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA029053-PA
Common NameOsI_30020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 203aa    MW: 22623.3 Da    PI: 10.3622
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA029053-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.9e-271766251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rie+ + rqv fskRr g++KKA+ELSvLCda+va+++fs+ g+lye++s
  BGIOSGA029053-PA 17 RIEDRTSRQVRFSKRRSGLFKKAYELSVLCDAQVALLVFSPAGRLYEFAS 66
                      8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-35867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.291868IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-281030IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-291087IPR002100Transcription factor, MADS-box
CDDcd002656.88E-341378No hitNo description
PfamPF003193.6E-261764IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-283045IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-284566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEGGGRRRKR GKVELRRIED RTSRQVRFSK RRSGLFKKAY ELSVLCDAQV ALLVFSPAGR  60
LYEFASSTSS IDTIFGRYWD LLDTTIDLNI EARESRVDCN IQVWIRRQIV HGGLAPLLVG  120
DATPPFRGVG VAPRLALCIY DDTPPRIKVA KAGGMEGGMM DVNDGLQEFG LHLMIALVWY  180
FMRQGSLGNK GSISGMTIIK VSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A3e-1810108290Myocyte-specific enhancer factor 2B
1n6j_B3e-1810108290Myocyte-specific enhancer factor 2B
1tqe_P3e-1810108391Myocyte-specific enhancer factor 2B
1tqe_Q3e-1810108391Myocyte-specific enhancer factor 2B
1tqe_R3e-1810108391Myocyte-specific enhancer factor 2B
1tqe_S3e-1810108391Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1512RRRKRGKV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.574191e-173seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160123451e-173
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429801e-170AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649438.16e-69PREDICTED: agamous-like MADS-box protein AGL3 isoform X2
TrEMBLA2YXF61e-148A2YXF6_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA029053-PA1e-148(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.17e-25AGAMOUS-like 14